<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4420 CA23584 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 65
2 D4T+ 3TC+ NFV 47
3 ADV+ NVP+ IDV 13
4 ADV+ ABC+ IDV+ NVP 30
5 NVP+ IDV+ ABC 25
6 ABC+ IDV+ RTV 8
7 ABC+ APV+ RTV+ D4T 52
8 3TC+ D4T+ ABC+ LPV 66

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M L33LI, Q58E, G73S, L89V L10I, I13V, I15IV, K20T, M36I, L63P, H69Y, A71V, I72E, V77I, V82I, I93L  
>CA23584| codons 1-99
PQITLWQRPIVTVKVGGQLTEALLDTGADDTIIEEINLPGRWKPKIVGGIGGFMKVREYD
QIPIEICGYKVESTVLIGPTPINIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, M184V, L210W, T215Y F77L     V21VI, E28K, K32KE, K43E, E44A, K104R, V118I, K122E, D177X, G196E, E203V, Q207E, H208Y, R211RK, R284K, I293V, E297A  
>CA23583| codons 1-300
PISPIETVPVKLKPGMDGPKIKQWPLTKEKIEALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPXIVI
YQYVDDLYVGSDLEIEQHRTKIVELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005