<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6595 CA23578 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 104
2 D4T+DDI+NFV+NVP 22
3 D4T+DDI+EFV+NFV 17
4 3TC+D4T+NFV 78
5 ABC+APV+D4T+RTV 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, V82A L24I, L33F L10I, K14KR, I15IV, Q18QH, N37D, I62V, L63P, A71V, T74A, T91TA  
>CA23578| codons 1-99
PQITLWQRPIVTIRVGGHLKEALIDTGADDTVFEEMDLPGRWKPKLIGGIGGFLKVRQYD
QVPIEICGHKVIGAVLVGPTPANIIGRNLLAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SS, L210LW, T215Y       K122E, I135L, S162C, T200A, E203ED, L228LH, A272P, I293V, E297Q  
>CA23577| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELRQHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTQEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005