<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  G140R D25E, V31I, M50I, G59R, G70R, I72V, F100Y, L101V, G106R, T112V, S119P, T124A, T125A, V126L, G134S, K136Q, G149R, R166K, V201I, T206S, I220V, R224Q, L234I, I251L, A265V, R269K, G272R, D278A G52R, S283G
>GA05| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAIHRQVDCSPRI
WQLDCTHLERKVILVAVHVASGYIEAEVIPAETGQETAYYVLKLARRWPVKVIHTDNGPN
FTSAALKAACWWASIQQEFRIPYNPQSQRVVESMNKELKKIIGQVKDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKVQNFQVYYRDSRDPIWKGPAK
LLWKGEGAVVLQDNSDIKVVPRRKVKIIKDYRKQMAGADCVAGRQDED

References
Author Title Citation
Oliveira, MF Genetic diversity and naturally polymorphisms in HIV type 1 integrase isolates from Maputo, Mozambique: Implications for integrase inhibitors. ARHR, 2012