<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9653 CA23572 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 22
2 3TC+AZT 139
3 D4T+DDI+NFV 136

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D T12N, E35D, M36I, R41K, K45KR, R57K, L63P, A71AT, I72V, I93L  
>CA23572| codons 1-98
PQITLWQRPLVNIKIGGQLKEALLDTGADNTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QIPIEICGHKTVGTVLVGPTPVNIIGRDLLTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y N348NI     S48T, I135MT, S162C, Q207E, R211K, E248Q, E291D, I293V, Q334QP, G359GS, K366KR, A376AT, T386TI, A400T, T403TA, E404ED, V435VA, L452LASV, R461RK, S468SP, H483HY, L491LS, A554HPSY, K558KR, V559VI  
>CA23571| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPQKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGPGQWTYQIYQEPFKILKTGKYARMRSA
HTNDVRQLTEAVQKITTESIVIWGKIPKFKLPIQKETWETWWADYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKVGKAGYVTDKGRQKVVPLTDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSYGIRRIL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005