<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9651 CA23565 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 61
2 D4T+DDI+NVP 18
3 3TC+AZT+NFV+NVP 175

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LI, M184V K219Q K103N A98G V35T, T39A, K122E, I135L, I142IV, T215X, D218DE, T286A, I293IV, E297A  
>CA23565| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFXTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTAEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10LV, K20T, E35D, M36I, R41K, I62V, L63P, A71V, I72IV, T74S, I93L  
>CA23566| codons 1-99
PQITLWQRPVVTIKIGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVVGSVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005