<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7113 CA23545 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 26
2 3TC+AZT+IDV 39
3 3TC+D4T 130
4 3TC+D4T+EFV 26
5 None 9
6 ABC+DDC+EFV 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V, M184V K219Q L100I, K103N   A98S, I135T, K166R, R211K, F214L, H221Y, L228R, V245M, A272P, K277R, T286A, E297K  
>CA23545| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPSGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDQKYQKEPPFRWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19I, N37S, I64V, V77I  
>CA23546| codons 1-98
PQITLWQRPLVTVKIGGQIKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLN

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012