<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9642 CA23540 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+IDV 144
2 AZT+DDC+NFV 71

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   L10I, M36I, K45KR, R57K, L63P, I93L  
>CA23540| codons 1-98
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPRMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRSLLTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, A158S, S162A, E203V, R211G, E297K  
>CA23539| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIVELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTKEA

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009