<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, S39C, L74I, L101I, I113L, T125A, H171Q, V201I, Q216H, I220L, N254S Y226YC
>101| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIIIVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTLHTDNGSN
FTSTAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEQLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKHITKLQNFRVCYRDSRDPLWKGPAK
LLWKGEGAVVIQDSSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Reigadas, S HIV-1 integrase variability and relationship with drug resistance in antiretroviral-naive and -experienced patients with different HIV-1 subtypes. J Antimicrob Chemother, 2013