<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6352 CA23521 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 82
2 AZT+DDC 26
3 3TC+AZT 99
4 3TC+AZT+NVP 188

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N K238T V21I, K104R, I135T, S162C, R211K, I257L, A272P, K277R, I293V  
>CA23521| codons 1-301
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNRSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDTWT
VQPIVLPEKDSWTVNDLQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37H, R41K, Q61E, I62V, I64V, T74A  
>CA23522| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMHLPGKWKPKMIGGIGGFIKVRQYD
EVLVEICGHKAIGAVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005