<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, K42Q, I84M, L101I, T112V, T124S, T125A, G134S, K136R, V201I, T206S, L234I, R269K, D278A S283G
>CN0354| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDQCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYMEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSSAVKAACWWASIRQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGADCVAGRQDED

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R211K, V245Q, E248Q, A272P, K277R, V292I, I293V, V317T, G335D, R356K, G359T, K366R, T377M, K390R, A400T, E404D, E432D, V435A, A437V, L452I, Q464K, D471E, H483Y, L484I, L491S, S519N, K530R, A534S, A554S  
>CN0354| codons 150-560
PQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHL
LKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPQKDSWTVNDIQKLVGKLNWASQ
IYPGIKVRQLCKLLRGTKALTEIVPLTEEAELELAENREILKEPVHGTYYDPSKDLIAEI
QKQGQDQWTYQIYQEPFKNLKTGKYAKMRTAHTNDVRQLTEAVQKIAMESIVIWGKTPKF
RLPIQKETWETWWTDYWQATWIPEWEFVNTPPLVKLWYQLEKDPIAGVETFYVDGAANRE
TKIGKAGYVTDRGRKKVVSLTETTNQKTELQAIYIALQDSGSEVNIVTDSQYALGIIQAQ
PDKSESELVNQIIEQLIKKERVYLSWVPAHKGIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Zeng, H Emergence of a new HIV type 1 CRF01_AE variant in Guangxi, southern China. ARHR, 2012