<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4345 CA23508 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 D4T+IDV 48
3 3TC+NFV 65
4 RTV+SQV 39
5 D4T+NVP+SQV 70
6 AZT+DDI+LPV 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48Q, I54T, V82F, L90M L33F, K43T L10I, K20R, E35D, M36I, N37D, R41K, Q61QE, I62V, L63T, I72V, V77I, L89I, I93L  
>CA23508| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVFEDIDLPGKWTPKIIQGIGGFTKVRQYD
EVTIEICGHKAVGTVLIGPTPFNIIGRNIMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y D67DG, K219N Y181C, G190GA   K20R, E44D, S68G, K101KQ, V118I, K122E, D123E, A272P, E291D, V292I  
>CA23507| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLWRWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009