<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9631 CA23493 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 83
2 3TC+AZT 30
3 3TC+AZT+IDV 270

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q     T39N, R83K, V90I, K122E, S162A, V179VI, T200A, E203D, D218E, A272P, I293V, E297A  
>CA23493| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRAKIDELRQHLLRWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTAEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A   E35D, N37S, L63P, A71V  
>CA23494| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEDMSLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009