<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK1573 UK1573 U.K. 2001 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ NVP 111
2 DDI+ D4T 76

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q Y181C   E6D, K11S, V35T, T39R, K43E, K64R, K122E, D123S, I135T, K173T, Q174K, Q207A, R211S, D218E  
>UK1573| codons 1-234
PISPIDTVPVSLKPGMDGPKVKQWPLTEEKIKALTEICREMEEEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFFTPEQKHQKEPPFLWMGYEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>UK1573| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005