<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK1557 UK1557 U.K. 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 EFV+ DDI NA
2 3TC+ D4T+ NFV 104
3 DDC+ SQV+ AZT NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10V, I13V, E35D, M36I, R41K, L63P  
>UK1557| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106M   K20R, V35T, T39M, K49R, V60I, K122E, D123N, I135T, S162C, D177E, I178L, T200A, E204K, Q207E, F214L  
>UK1557| codons 1-230
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICMEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLRWGLTTPDKKHQKEPPFLWM

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005