<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, K43R, T69S, K122E, D123S, S162C, K173I, Q174K, D177E, I178M, T200A, Q207K, R211S, K238R, V245E, A272P, K281R, T286A, E291D, V292I, I293V, K311R, E312T, I326V, I329V, G335D, M357K, G359S, K366R, A371V, K390R, A400T, T403M, E432D, V435A, N447S, V458I, D471E, Q480H, H483Q, L491S, I505V, K512R, E514D, L517V, S519N, Q524E, A534S, A554S  
>CN1396| codons 1-560
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILRTPVHGVYYDPSKDLVAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTEVVQKIATESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGAETFYVDGAASRETKLGKAGYITDRGRQKVVSLTETTNQKTELH
AIQLALQDSGSEVNIVTDSQYALGVIQAQPDRSDSEVVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, R41K, L63P, H69K, K70Q, L89M  
>CN1396| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKQAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    W19C, V31I, S39N, I72V, T112V, T124N, T125A, G134N, I135V, K136R, D167E, V201I, L234I S283G
>CN1396| codons 1-288
FLDGIDKAQEEHEKYHSNCRAMASDFNLPPIVAKEIVANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSNAVKAACWWANVRQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Zeng, H Emergence of a new HIV type 1 CRF01_AE variant in Guangxi, southern China. ARHR, 2012