<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, I72V, Q95H, T112V, T124A, T125A, G134N, I135V, K136Q, D167E, V201I, L234I S283G
>CN1320| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGHETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, N37D, R41K, H69K, K70R, L89M  
>CN1320| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, K32I, V35T, T39K, K43Q, D123N, S162C, K173I, Q174K, D177E, V179I, Q207K, R211S, K238R, V245E, I274V, T286A, E291D, V292I, I293V, E312N, I329V, G335D, M357K, G359S, K366R, A371V, A376T, K390R, A400T, T403M, E432D, N447S, Q464K, D471E, Q480H, L491S, K512R, L517V, S519N, Q524E, A534S, A554S  
>CN1320| codons 1-560
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIIALTEICKEMEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGVKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTEVVQKITTESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAASRETKLGKAGYVTDRGRKKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEVVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Zeng, H Emergence of a new HIV type 1 CRF01_AE variant in Guangxi, southern China. ARHR, 2012