<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK1516 UK1516 U.K. 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+ PI+ NNRTI NA
2 NVP+ LPV+ EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215F K70S, K219Q K101KE, K103KN, G190A   E28A, V35T, K49KR, V60I, S68G, K122E, I135T, K173L, Q174K, D177E, I178M, V179I, T200A, I202V, Q207E  
>UK1516| codons 1-234
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKNGTSWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEMII
YQYMDDLYVASDLEIGQHRAKVEELREHLLRWGFFTPDQKHQKEPPFLWMGYEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L   L10I, I13V, G16E, K20T, E35D, M36I, R41K, R57K, L63T, H69K, T74S, V82VI, I85V, L89M  
>UK1516| codons 1-99
PQITLWQRPIVTVKIEGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFLKVKQYD
QITIEICGKKAIGSVLVGPTPINIVGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005