<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK1447 UK1447 U.K. 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ IDV+ 3TC 39
2 EFV+ AZT+ ABC 43
3 DDI+ RTV+ SQV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GA, I54V, V82A, I84V, L90M L23LI, K43KT L10Y, I15V, M36I, R41K, I62V, L63V, H69K, A71V, T74S, L89LM, I93L  
>UK1447| codons 1-99
PQITLWQRPYVTIKVGGQLKEAILDTGADDTVLEEINLPGKWTPKMIAGIGGFVKVRQYD
QVVIEICGKKVIGSVLVGPTPANVIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y K219R K103N P225H V35T, T39E, S48T, K122E, D123S, I135L, K173T, Q174K, T200A, Q207E, R211RK, L228R  
>UK1447| codons 1-234
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDRKHQKEHPFRWMGYEL

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005