<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK1428a UK1428a U.K. 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ D4T+ DDI 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   T27S, V35K, T39E, E42K, K122E, D123S, I135R, S162A, E169D, K173A, D177E, T200A, Q207E, H221Y  
>UK1428a| codons 1-234
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALKEICEEMKKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILDPFRAQNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKYQKEPPFLWMGYEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I   I15V, L19I, M36I, N37S, R41K, H69K, T74S, L89M, I93L  
>UK1428a| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEISLPGKWKPKIIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005