<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK1147 UK1147 U.K. 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ 3TC+ AZT 34
2 3TC+ D4T+ IDV 47
3 DLV+ ABC+ NFV 70

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I K43T T12S, I15V, L19I, K20T, E35D, M36I, N37D, D60E, Q61E, L63P, H69K, A71T, L89T, I93L  
>UK1147| codons 1-99
PQITLWQRPLVSIKVGGQITEALLDTGADDTVLEDIDLPGRWTPKIIGGIGGFIKVRQYE
EIPIEICGKKTIGTVLVGPTPVNIIGRNTLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   M230L   V35T, E36A, T39D, V60I, V90I, K173T, Q174K, I178L, E203D, Q207E  
>UK1147| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDLVI
YQYVDDLYVGSDLEIGQHRTKIDELREHLLRWGFYTPDKKHQKEPPFLWLGYELHPD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005