<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK989 UK989 U.K. 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ EFV+ 3TC 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   V106M, G190A K101N V35T, T39E, S48T, A98S, K173M, T200Q, Q207E, R211K  
>UK989| codons 1-226
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLNKKKSMTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRMQNPDIVI
YQYVDDLYVASDLEIGQHRQKIEELREHLLKWGFTTPDKKHQKEPP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, N37S, R41K, L63T, H69K, L89M, I93L L38LP
>UK989| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEISPPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005