Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| UK955 | UK955 | U.K. | 2000 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ DDI | 61 |
| 2 | DDI+ AZT | 52 |
| 3 | 3TC+ D4T | 30 |
| 4 | SQV+ D4T+ DDC | 13 |
| 5 | SQV+ 3TC+ DDC | 8 |
| 6 | SQV+ 3TC+ AZT | 8 |
| 7 | DDC+ SQV+ AZT+ RTV | 26 |
| 8 | RTV+ DDI+ AZT+ NVP | 17 |
| 9 | 3TC+ NVP+ RTV | 12 |
| 10 | NVP+ ABC+ IDV+ RTV+ 3TC | 39 |
| 11 | IDV+ AZT+ RTV+ NVP+ 3TC | 14 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, I84V, L90M | G73S, L89V | L10I, I15V, L19I, K20X, E35D, M36I, R41K, D60E, I62IV, L63P, H69K, A71V, I85V, I93L |
| >UK955| codons 1-99 PQITLWQRPIVTIKVGGQIXEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYE QVPIEICGKKVISTVLVGPTPVNVVGRNVMTQLGCTLNF |
References
| Author | Title | Citation |
| Non-B Workgroup | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |