<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK955 UK955 U.K. 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 61
2 DDI+ AZT 52
3 3TC+ D4T 30
4 SQV+ D4T+ DDC 13
5 SQV+ 3TC+ DDC 8
6 SQV+ 3TC+ AZT 8
7 DDC+ SQV+ AZT+ RTV 26
8 RTV+ DDI+ AZT+ NVP 17
9 3TC+ NVP+ RTV 12
10 NVP+ ABC+ IDV+ RTV+ 3TC 39
11 IDV+ AZT+ RTV+ NVP+ 3TC 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M G73S, L89V L10I, I15V, L19I, K20X, E35D, M36I, R41K, D60E, I62IV, L63P, H69K, A71V, I85V, I93L  
>UK955| codons 1-99
PQITLWQRPIVTIKVGGQIXEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYE
QVPIEICGKKVISTVLVGPTPVNVVGRNVMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005