<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK598 UK598 U.K. 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 200
2 AZT+ DDC 156
3 3TC+ AZT 17
4 3TC+ D4T 43
5 NVP+ IDV+ DDI 97

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, I15V, G16E, L19I, M36I, R41K, K45R, L63H, H69K, L89I, I93L  
>UK598| codons 1-99
PQITLWQRPLVSIKVEGQIKEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNIMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005