<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK538 UK538 U.K. 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 27
2 RTV+ 3TC+ D4T+ SQV 4
3 D4T+ NVP+ 3TC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    V11X, T12S, I15V, L19T, K20R, M36I, R41K, D60E, L63P, H69K, V77I, L89M, I93L  
>UK538| codons 1-99
PQITLWQRPLXSIKVGGQTREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005