<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK496b UK496b U.K. 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ D4T+ DDI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, I13V, L19I, K20T, M36I, R41K, D60E, L63P, I64V, H69K, L89M, I93L  
>UK496b| codons 1-99
PQITLWQRPLVSVKIGGQITEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QIPVEICGKKAIGTVLVGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      G190GR V35T, E36A, T39D, K122E, K173T, D177E, Q197R, T200V, Q207N, R211K P150PA
>UK496b| codons 1-227
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLAQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYMDDLYVRSDLEIGRHRVKIEELRNHLLKWGFTTPDKKHQKEPPF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005