<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK456b UK456b U.K. 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT NA
2 NFV+ 3TC+ D4T NA
3 EFV+ ABC+ DDC NA
4 DDC+ DDI+ EFV NA
5 D4T+ RTV+ IDV+ DDI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10LI, T12S, L19I, K20I, M36I, R41K, L63P, I64V, H69K, A71V, T74S, L89M, I93L  
>UK456b| codons 1-99
PQITLWQRPIVSIKIGGQIIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYD
QIPVEICGKKVIGSVLVGPTPVNIIGRNMMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005