Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| UK456b | UK456b | U.K. | 2000 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDI+ AZT | NA |
| 2 | NFV+ 3TC+ D4T | NA |
| 3 | EFV+ ABC+ DDC | NA |
| 4 | DDC+ DDI+ EFV | NA |
| 5 | D4T+ RTV+ IDV+ DDI | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, L90M | L10LI, T12S, L19I, K20I, M36I, R41K, L63P, I64V, H69K, A71V, T74S, L89M, I93L |
| >UK456b| codons 1-99 PQITLWQRPIVSIKIGGQIIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYD QIPVEICGKKVIGSVLVGPTPVNIIGRNMMTQLGCTLNF |
References
| Author | Title | Citation |
| Non-B Workgroup | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |