<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I15V, E35D, M36I, R41K, R57K, L63A, E65D, L89M I93D
>SR112| codons 1-99
PQITLWQRPLVPIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIAIDICGHKAIGTVLVGPTPVNIIGRNMLTQDGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R       V35T, T39A, E40D, D123E, S134R, S162Y, K173T, Q174K, I178L, I195L, T200A, Q207AT, R211K, I244IL, V245Q, E248D, A272P, K281R, T286A, E291D, V292I, I293V, P294T, E297A L120S, I135H, P150S, G152R
>SR112| codons 1-313
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPS
DKEFRKYTAFTIPRHNNETPGIRYQYNVLSQRWKGSPAIFQYSMTKILEPFRTKNPDLVI
YQYMDDLYVGSDLELGQHRAKIEELRTHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPLQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDIVTLTAEAE
LELAENREILKEP

References
Author Title Citation
Temereanca, A Transmitted HIV drug resistance in newly diagnosed, treatment-naive Romanian patients. J Med Virol, 2013