<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PHI-2 PHI-2 Switzerland 2005 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, E35D, M36I, P39T, R41K, R57K, D60E, Q61N, H69Y, I72T, L89M  
>PHI-2| codons 1-99
PQITLWQRPVVTVKIEGQLKEALLDTGADDTVLEDINLTGKWKPKMIGGIGGFIKVKQYE
NILIEICGYKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35I, E40D, K49R, I63X, D123E, I135L, S162C, E169D, K173T, Q174K, D177E, I178L, Q207D, R211K, V245Q, E248D  
>PHI-2| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTDMEKEGKISRIGPENPYNTPV
FAXKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRTKNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKD

References
Author Title Citation
Castro, E HIV-1 drug resistance transmission networks in southwest Switzerland. ARHR, 2010