<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PHI-4 PHI-4 Switzerland 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, R41K, L63V, I64M, H69K, L89M  
>PHI-4| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P14T, V35T, E40D, I135V, S162A, F171Y, K173T, Q174K, D177E, T200A, I202V, Q207E, R211S, F214L, V245Q  
>PHI-4| codons 1-250
PISPIETVPVKLKTGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPYRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELREHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKD

References
Author Title Citation
Castro, E HIV-1 drug resistance transmission networks in southwest Switzerland. ARHR, 2010