<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK162 UK162 U.K. 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC 82
2 D4T+ 3TC+ RTV 57

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A, L90M K43T T12S, I15V, L19I, K20R, M36I, R41K, K55R, Q61E, I62V, L63V, H69K, T74S, L89M, I93L D25E
>UK162| codons 1-99
PQITLWQRPLVSIKVGGQIREALLETGADDTVLEEINLPGKWTPKIIGGIGGFIRVRQYD
EVVIEICGKKAIGSVLVGPTPANIIGRNMMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005