<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
102-1113 102-1113 Burundi 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L74M E10Q, E11D, E13D, V31I, M50I, I72V, L101I, T112V, I113V, T124N, F181L, K188R, G193E, V201I, T218I, L234I, A265V, R269K, D278A  
>102-1113| codons 1-288
FLDGIDKAQQDHDKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVIMVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVVHTDNGSN
FTSNTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
LIHNFKRRGGIGEYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVASRQDED

References
Author Title Citation
Monleau, M Drug resistance mutations of HIV type 1 non-B viruses to integrase inhibitors in treatment-naive patients from sub-saharan countries and discordant interpretations. ARHR, 2012