<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
102-1024 102-1024 Burundi 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, E13D, K14KR, V31VI, E87ED, Y99YF, L101I, T112V, T124S, D167E, K173R, K188KR, V201I, T206S, L234I, A265V, R269K, D278A L45L*Q, A276AE
>102-1024| codons 1-288
FLDGIEKAQEEHDRYHSNWRAMASDFNLPPIVAKEIVASCDKCQQKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEADVIPAETGQETAFFILKLAGRWPVKVIHTDNGSN
FTSSTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLRTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMEGADCVASRQDED

References
Author Title Citation
Monleau, M Drug resistance mutations of HIV type 1 non-B viruses to integrase inhibitors in treatment-naive patients from sub-saharan countries and discordant interpretations. ARHR, 2012