<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA71_2504 SA71_2504 South Africa 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 6
2 D4T+ DDI 50

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M V75I, F77L, F116Y     V35T, E36A, T39E, S48T, S68G, V111I, K122E, D123G, I135V, K173A, T200E, Q207A, R211K, V245Q, A272P, K275Q, Q278K, T286A, E291D, V292I, I293V G15A
>SA71_2504| codons 10-317
VKLKPAMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPVFAIKKKDGT
KWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYYSVPLDEGFRKYTA
FTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRAQNPDIVIYQYMDDLYV
GSDLEIGQHREKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEK
DSWTVNDIQKLVGKLNWASQIYPGIQVKKLCKLLRGAKALTDIVPLTEEAELELAENREI
LKEPVHGV

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005