<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA67_1216 SA67_1216 South Africa 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T 6
2 D4T+ DDI 50

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, T69N, K122E, D123G, K173T, T200A, Q207E, V245H, K277R, T286A, E291D, V292I, I293V  
>SA67_1216| codons 10-310
VKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPVFAIKKKDSN
KWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTA
FTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDIVIYQYMDDLYV
GSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIHLPEK
DSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVPLTEEAELELAENREI
L

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005