<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA65_1158 SA65_1158 South Africa 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T 6
2 DDI+ D4T 50

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, E36A, T39E, S48T, T69N, K122E, D123N, K166R, K173T, D177E, I178M, T200A, E204K, Q207E, V245L, A272P, K277R, E291D, V292I, I293V, P294T  
>SA65_1158| codons 10-316
VKLKPGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPVFAIKKKDSN
KWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTA
FTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTQNPEMVIYQYMDDLYV
GSDLEIGQHRAKIEKLREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPILLPEK
DSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVTLTEEAELELAENREI
LKEPVHG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005