<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA63_1070 1070A_12M South Africa 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 6
2 DDI+ D4T 45

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, T69N, K122E, D123G, K173T, Q174K, T200A, Q207E, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V  
>1070A_12M| codons 10-317
VKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPVFAIKKKDSN
KWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTA
FTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVIYQYMDDLYV
GSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEK
DSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAELELAENREI
LKEPVHGV

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005