<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA41_1034 SA41_1034 South Africa 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI 6
2 DDI+ D4T 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      A98G V35T, E36V, T39E, S48T, V60I, K104R, K122E, D123S, I135M, K173T, T200A, Q207E, V245Q, D250E, A272P, K275R, K277R, Q278H, T286A, E291D, V292I, I293V  
>SA41_1034| codons 10-313
VKLKPGMDGPKVKQWPLTEEKIKALTVICEEMEKEGKITKIGPENPYNTPIFAIKKKDST
KWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKRSVTVLDVGDAYFSVPLDESFRKYTA
FTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDIVIYQYMDDLYV
GSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEK
ESWTVNDIQKLVGKLNWASQIYPGIRVRHLCKLLRGAKALTDIVPLTEEAELELAENREI
LKEP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005