<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
00ZA_AC1 00ZA_AC1 South Africa 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, V118I, K122E, D123S, T165I, K166R, P176T, T200A, Q207E, F214L, V245L, A272P, Q278H, T286A, A288T, E291D, V292I, I293V  
>00ZA_AC1| codons 10-316
VKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPVFAIKKKDST
KWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDESFRKYTA
FTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIRILEPFRKQNTDIVIYQYMDDLYV
GSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPILLPEK
DSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGAKTLTDIVPLTEEAELELAENREI
LKEPVHG

References
Author Title Citation
Pillay, C HIV-1 subtype C reverse transcriptase sequences from drug-naive pregnant women in South Africa. ARHR, 2002