<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE59 BE59 Belgium 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 SQV+ AZT+ DDC 51
3 D4T+ DDI+ IDV 13
4 IDV+ AZT+ 3TC+ DDI+ D4T 1
5 AZT+ 3TC+ IDV 30
6 AZT+ SQV+ RTV+ 3TC 21
7 3TC+ AZT 24
8 ABC+ NFV+ NVP 5
9 NVP+ NFV+ D4T 20
10 3TC+ NFV+ SQV 76

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54A, V82A L33F, K43KT L10I, I13V, I15V, L19I, M36L, N37EQ, L38M, I62V, L63V, H69K, I72V, T74S, L89LI, I93L  
>BE59| codons 1-99
PQITLWQRPIVTVKVGGQIKEALLDTGADDTVFEELEMPGRWTPKMIVGIGGFAKVRQYD
QVVIEICGKKAVGSVLVGPTPANIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215HY K219N G190GA F227FL P4PS, K20R, V35T, T39E, E44D, K122E, T139TA, K173T, I178IM, T200E, E203K, Q207E, H208Y, R211K, K223E, L228LR, V245H, D250E, A272P, L283I, T286V, E291D, V292I, I293V, D324E  
>BE59| codons 1-325
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDMVI
YQYVDDLYVASDLEIGQHREKIKELREYLWKWGFYTPDNKHQEEPPLRWMGYELHPDKWT
VQPIHLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGVKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKEL

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Snoeck, J Rising prevalence of HIV-1 non-B subtypes in Belgium: 1983-2001. JAIDS, 2004