<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
08MB42ZA 08MB42ZA South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    L74I, L101I, T112V, T125P, K136Q, V201I, K211R, T218I, K219Q, L234I S283G, D288N
>08MB42ZA| codons 34-288
KEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIIIVAVHVASGYIEAEVIPAET
GQETAYFILKLAGRWPVKVIHTDNGSNFTSTPVKAACWWAGIQQEFGIPYNPQSQGVVES
MNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIIDIIATDIQTREL
QKQIIQIQNFRVYYRDSRDPIWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGK
QMAGDDCVAGRQDEN

References
Author Title Citation
Bessong, PO Genetic analysis of HIV-1 integrase sequences from treatment naive individuals in northeastern South Africa. Int J Mol Sci, 2013