<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V G190A   V35T, T39E, K122E, D123N, I135T, K173R, Q174K, D177E, I178M, T200I, E203K, Q207D, K238R  
>KH043| codons 24-239
WPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKR
TQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIR
YQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPEMVIYQYVDDLYVASDLEIGQHRIKIK
ELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDRW

References
Author Title Citation
Coetzer, M Extensive drug resistance in HIV-infected Cambodian children who are undetected as failing first-Line antiretroviral therapy by WHO 2010 guidelines. ARHR, 2013