<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, E28K, K32E, V35T, E36A, T39D, S48T, E53D, V60I, T69S, I135V, S162C, I178L, Q207E, V245Q, A272P, K277R, E291D, V292I, I293V  
>11YNHH118| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIEALTAICDEMEKEGKITKIGPDNPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, M36I, R41K, D60E, L63P, H69K, L89M, I93L  
>11YNHH118| codons 1-99
PQITLWQRPLVSIKVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Chen, M HIV-1 genotypes and drug resistance threshold survey in Honghe Prefecture of Yunnan Province in 2011 Direct Genbank Submission, 2013