<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE40 BE40 Belgium 2000 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 15
2 AZT+ DDC+ SQV 75
3 3TC+ SQV+ D4T 33
4 DDI+ IDV+ D4T 35
5 IDV+ 3TC+ D4T+ NVP 25
6 NVP+ D4T+ NFV+ 3TC 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, I15V, K20M, R41K, D60E, I62V, L63P, A71T, I72V, V75I, L89M, I93L  
>BE40| codons 1-99
PQITLWQRPIVTIKVGGQLMEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYE
QVPIEICGHKTVGTILVGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   Y181C V108I V35T, K49R, V60I, T69N, K122E, D177E, Q207E, P243T, V245K, D250E  
>BE40| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIKLPEKESWTVNDIQK

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Snoeck, J Rising prevalence of HIV-1 non-B subtypes in Belgium: 1983-2001. JAIDS, 2004