<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE4 BE4b Belgium 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 NFV+ DDI+ D4T 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P14PQ, V35T, E36A, T39E, S48T, K104R, K122E, D123G, I135T, K173A, D177E, T200A, I202V, Q207G, R211G, V245Q, A272S, K277R, E291D, V292I, I293V, H315Y, G333E, Q334H, G335S  
>BE4b| codons 1-340
PISPIETVPVKLKQGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELRGHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVYGVYYDPSKDLIAEIQKQEHSQWTYQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, L19I, E35D, M36I, R41K, H69K, L89M, I93L  
>BE4b| codons 13-99
IRVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAI
GTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Snoeck, J Prevalence and origin of HIV-1 group M subtypes among patients attending a Belgian hospital in 1999. Virus Res, 2002