<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE29 BE29 Belgium 1998 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20KR, M36I, R41K, K43R, H69K, L89M  
>BE29| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39E, K122E, D123S, I135T, K173I, Q174K, D177E, Q207A, R211S, V245EK S117S*, E233EV
>BE29| codons 1-256
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYF*VPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYVLHPDKWT
VQPIKLPEKDSWTVND

References
Author Title Citation
Snoeck, J Rising prevalence of HIV-1 non-B subtypes in Belgium: 1983-2001. JAIDS, 2004