<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE25 BE25 Belgium 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 545

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q     K11T, V35IT, T39X, V60VI, T69TN, K122E, D123N, I135T, E138EA, I142IV, K166R, K173S, I202V, Q207A, R211S, F214L, V245Q, E248D, K277R, T286A, E291D, V292VI, I293V, P294V, E312N  
>BE25| codons 1-324
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALIEICXEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRSQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLSWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVVLTEEAE
LELAENREILKNPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TP, I13V, L19I, E35D, M36I, R41K, K45R, H69K, L89M  
>BE25| codons 1-99
PQITLWQRPLVPVKIGGQIKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Snoeck, J Rising prevalence of HIV-1 non-B subtypes in Belgium: 1983-2001. JAIDS, 2004