<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, S39N, I72V, Q95N, T112V, T124A, T125A, G134N, I135V, K136R, D167E, V201I, L234I S283G
>04TH312908| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPVVAKEIVANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGNETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVRQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15L, E35D, R41K, L63P, A71T, I93L  
>04TH312908| codons 1-99
PQITLWQRPIVTIKLGGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35I, K173I, Q174K, D177E, I178M, G196E, Q207A, R211S, V245E, V276I, T286A, E291D, V292I, E297T, E312T, P313T, I329V, G335D, M357K, G359S, K366R, T369A, A371V, K390R, K395R, A400T, T403M, E432D, L452I, D460N, D471E, Q480H, L491S, I506L, K512R, L517V, S519N, Q524E, A534S, A554S  
>04TH312908| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIEQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGAKALTDIIPLTTEAE
LELAENREILKTTVHGVYYDPSKDLIAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLAEVVQKIATESIVIWGKTPKFRLPIQRETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKIGKAGYVTNRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGILQAQPDRSESEVVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Kijak, GH HIV-1 prevalence and subtype distribution in HIV-1 positive volunteers deferred from enrollment in a phase III prime-boost HIV-1 vaccine trial in Thailand J Virol, 2013