<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE16a BE16a Belgium 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 6
2 AZT+ 3TC 20
3 AZT+ 3TC+ IDV 107

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V35T, T39N, S48SL, V60I, D121DH, K122KE, D123DGNS, R125RG, I135R, K173I, Q174K, D177E, T200A, Q207E, R211K, F214L P119PL, N136NT
>BE16a| codons 23-230
QWPLTEEKIKALTEICNEMEKEGKILKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNK
RTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVLLHESFGKYTAFTIPSRTNETPGI
RYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVIYQYVDDLYVGSDLEIGQHRAKI
EELREHLLKWGLTTPDQKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A L24I L10IM, T12TS, I15V, L19T, M36I, R41K, K43KN, R57RS, D60E, Q61E, L63P, H69K, L89M, I93L  
>BE16a| codons 1-99
PQITLWQRPIVSIKVGGQTKEALIDTGADDTVLEEINLPGKWNPKIIGGIGGFIKVSQYE
EIPIEICGKKAIGTVLVGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Snoeck, J Prevalence and origin of HIV-1 group M subtypes among patients attending a Belgian hospital in 1999. Virus Res, 2002