<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE14a BE14a Belgium 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T 15
2 D4T+ 3TC+ IDV 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20KR, V35VAIT, T39X, E40ED, V60VI, V118VI, K122E, D123DN, I135T, R172K, D177E, I178L, T200TA, E204EK, Q207QE, F214L, H221HY, V245T, D250E, A272P, T286A, I293V, P294T, K311R, V317VA, I329V, Q334N  
>BE14a| codons 1-341
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICXDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPELVI
YQYVDDLYVGSDLEIGQHRAKIEKLREHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVTLTEEAE
LELAENREILREPVHGAYYDPSKDLIAEVQKQGNGQWTYQI

References
Author Title Citation
Snoeck, J Rising prevalence of HIV-1 non-B subtypes in Belgium: 1983-2001. JAIDS, 2004