<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE13b BE13b Belgium 1998 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 245
2 3TC+ AZT 25
3 D4T+ AZT+ IDV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L24I T12S, I15V, L19I, M36I, N37K, R41N, K45R, L63P, H69K, L89T, I93L  
>BE13b| codons 1-95
PQITLWQRPLVSIKVGGQIKEALIDTGADDTVLEEIKLPGNWKPRIIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNTLTQLGC

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Snoeck, J Rising prevalence of HIV-1 non-B subtypes in Belgium: 1983-2001. JAIDS, 2004